Recombinant Human ABCC2 Protein, GST-Tagged

• Cat.No.: ABCC2-047H
• Product Overview: Human ABCC2 partial ORF ( NP_000383, 214 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine; therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: LKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ABCC2 ATP-binding cassette, sub-family C (CFTR/MRP), member 2 [ Homo sapiens ]
• Official Symbol: ABCC2
• Synonyms: ABCC2; ATP-binding cassette, sub-family C (CFTR/MRP), member 2; canalicular multispecific organic anion transporter 1 , CMOAT; canalicular multispecific organic anion transporter 1; cMRP; DJS; MRP2; canalicular multidrug resistance protein; multidrug resistance-associated protein 2; ATP-binding cassette sub-family C member 2; ABC30; CMOAT
• Gene ID: 1244
• mRNA Refseq: NM_000392
• Protein Refseq: NP_000383
• MIM: 601107
• UniProt ID: Q92887