Recombinant Human ABCC13 Protein, GST-Tagged
Cat.No. : | ABCC13-046H |
Product Overview : | Human ABCC13 full-length ORF ( ENSP00000345983, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene is a member of the superfamily of genes encoding ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This family member is part of the MRP subfamily, which is involved in multi-drug resistance, but the human locus is now thought to be a pseudogene incapable of encoding a functional ABC protein. Alternative splicing results in multiple transcript variants; however, not all variants have been fully described. [provided by RefSeq, Jul 2008] |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 45.9 kDa |
AA Sequence : | MLSSTQNAGGSYQRVRGALDTQKCSPEKSASFFSKVTYSWFSRVITLGYKRPLEREDLFELKESDSFCTACPIFEKQWRKEVLRNQERQKVKVSCYKEAHIKKPSLLYALWNTFKSILIQVALFKVFADILSFTSPLIMNYTRKVNYLMGLPCENQKITSYSQASGRDS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABCC13 ATP-binding cassette, sub-family C (CFTR/MRP), member 13, pseudogene [ Homo sapiens ] |
Official Symbol | ABCC13 |
Synonyms | ABCC13; ATP-binding cassette, sub-family C (CFTR/MRP), member 13, pseudogene; ATP binding cassette, sub family C (CFTR/MRP), member 13; ATP-binding cassette protein C13; C21orf73; PRED6; |
Gene ID | 150000 |
mRNA Refseq | NM_138726 |
MIM | 608835 |
UniProt ID | Q9NSE7 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ABCC13 Products
Required fields are marked with *
My Review for All ABCC13 Products
Required fields are marked with *
0
Inquiry Basket