Recombinant Human ABCC13 Protein, GST-Tagged

Cat.No. : ABCC13-046H
Product Overview : Human ABCC13 full-length ORF ( ENSP00000345983, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the superfamily of genes encoding ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This family member is part of the MRP subfamily, which is involved in multi-drug resistance, but the human locus is now thought to be a pseudogene incapable of encoding a functional ABC protein. Alternative splicing results in multiple transcript variants; however, not all variants have been fully described. [provided by RefSeq, Jul 2008]
Molecular Mass : 45.9 kDa
AA Sequence : MLSSTQNAGGSYQRVRGALDTQKCSPEKSASFFSKVTYSWFSRVITLGYKRPLEREDLFELKESDSFCTACPIFEKQWRKEVLRNQERQKVKVSCYKEAHIKKPSLLYALWNTFKSILIQVALFKVFADILSFTSPLIMNYTRKVNYLMGLPCENQKITSYSQASGRDS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABCC13 ATP-binding cassette, sub-family C (CFTR/MRP), member 13, pseudogene [ Homo sapiens ]
Official Symbol ABCC13
Synonyms ABCC13; ATP-binding cassette, sub-family C (CFTR/MRP), member 13, pseudogene; ATP binding cassette, sub family C (CFTR/MRP), member 13; ATP-binding cassette protein C13; C21orf73; PRED6;
Gene ID 150000
mRNA Refseq NM_138726
MIM 608835
UniProt ID Q9NSE7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ABCC13 Products

Required fields are marked with *

My Review for All ABCC13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon