Recombinant Human ABCC13 Protein, GST-Tagged

• Cat.No.: ABCC13-046H
• Product Overview: Human ABCC13 full-length ORF ( ENSP00000345983, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is a member of the superfamily of genes encoding ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This family member is part of the MRP subfamily, which is involved in multi-drug resistance, but the human locus is now thought to be a pseudogene incapable of encoding a functional ABC protein. Alternative splicing results in multiple transcript variants; however, not all variants have been fully described. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 45.9 kDa
• AA Sequence: MLSSTQNAGGSYQRVRGALDTQKCSPEKSASFFSKVTYSWFSRVITLGYKRPLEREDLFELKESDSFCTACPIFEKQWRKEVLRNQERQKVKVSCYKEAHIKKPSLLYALWNTFKSILIQVALFKVFADILSFTSPLIMNYTRKVNYLMGLPCENQKITSYSQASGRDS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ABCC13 ATP-binding cassette, sub-family C (CFTR/MRP), member 13, pseudogene [ Homo sapiens ]
• Official Symbol: ABCC13
• Synonyms: ABCC13; ATP-binding cassette, sub-family C (CFTR/MRP), member 13, pseudogene; ATP binding cassette, sub family C (CFTR/MRP), member 13; ATP-binding cassette protein C13; C21orf73; PRED6
• Gene ID: 150000
• mRNA Refseq: NM_138726
• MIM: 608835
• UniProt ID: Q9NSE7