Recombinant Human ABCC1 protein(871-960 aa), C-His-tagged

• Cat.No.: ABCC1-2727H
• Product Overview: Recombinant Human ABCC1 protein(P33527)(871-960 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 871-960 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: STEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKL
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: ABCC1 ATP-binding cassette, sub-family C (CFTR/MRP), member 1 [ Homo sapiens ]
• Official Symbol: ABCC1
• Synonyms: ABCC1; ATP-binding cassette, sub-family C (CFTR/MRP), member 1; MRP, MRP1, multidrug resistance associated protein 1; multidrug resistance-associated protein 1; GS X; LTC4 transporter; leukotriene C(4) transporter; ATP-binding cassette transporter variant ABCC1delta-ex13; ATP-binding cassette transporter variant ABCC1delta-ex25; ATP-binding cassette transporter variant ABCC1delta-ex13and 14; ATP-binding cassette transporter variant ABCC1delta-ex25& 26; MRP; ABCC; GS-X; MRP1; ABC29; DKFZp781G125; DKFZp686N04233
• Gene ID: 4363
• mRNA Refseq: NM_004996
• Protein Refseq: NP_004987
• MIM: 158343
• UniProt ID: P33527