Recombinant Human ABCB9 Protein, GST-Tagged

• Cat.No.: ABCB9-041H
• Product Overview: Human ABCB9 partial ORF ( NP_062571, 482 a.a. - 580 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. This family member functions in the translocation of peptides from the cytosol into the lysosomal lumen. Alternative splicing of this gene results in distinct isoforms which are likely to have different substrate specificities. [provided by RefSeq, Jul 2011]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: FIDRQPTMVHDGSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLEGGRVLLDGKPISAYDHKYLHR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ABCB9 ATP-binding cassette, sub-family B (MDR/TAP), member 9 [ Homo sapiens ]
• Official Symbol: ABCB9
• Synonyms: ABCB9; ATP-binding cassette, sub-family B (MDR/TAP), member 9; ATP-binding cassette sub-family B member 9; EST122234; TAP-like protein; ABC transporter 9 protein; TAPL; KIAA1520
• Gene ID: 23457
• mRNA Refseq: NM_001243013
• Protein Refseq: NP_001229942
• MIM: 605453
• UniProt ID: Q9NP78