Recombinant Human ABCB1, His-tagged

Cat.No. : ABCB1-30530TH
Product Overview : Recombinant fragment, corresponding to amino acids 1036-1280 of Human P Glycoprotein with N terminal His tag; Predicted MWt 28 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1036-1280 a.a.
Description : The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is an ATP-dependent drug efflux pump for xenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier.
Conjugation : HIS
Tissue specificity : Expressed in liver, kidney, small intestine and brain.
Form : Lyophilised:Reconstitute with 37 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCG KSTVVQLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHL GIVSQEPILFDCSIAENIAYGDNSRVVSQEEIVRAAKE ANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARA LVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIV IAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIY FSMVSVQAGTKRQ
Sequence Similarities : Belongs to the ABC transporter superfamily. ABCB family. Multidrug resistance exporter (TC 3.A.1.201) subfamily.Contains 2 ABC transmembrane type-1 domains.Contains 2 ABC transporter domains.
Gene Name ABCB1 ATP-binding cassette, sub-family B (MDR/TAP), member 1 [ Homo sapiens ]
Official Symbol ABCB1
Synonyms ABCB1; ATP-binding cassette, sub-family B (MDR/TAP), member 1; CLCS, colchicin sensitivity , MDR1, PGY1; multidrug resistance protein 1; ABC20; CD243; GP170; P gp;
Gene ID 5243
mRNA Refseq NM_000927
Protein Refseq NP_000918
MIM 171050
Uniprot ID P08183
Chromosome Location 7q21.12
Pathway ABC transporters, organism-specific biosystem; ABC transporters, conserved biosystem; ABC-family proteins mediated transport, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem;
Function ATP binding; ATPase activity; ATPase activity, coupled to transmembrane movement of substances; hydrolase activity; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ABCB1 Products

Required fields are marked with *

My Review for All ABCB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon