Recombinant Human ABCA6 Protein, GST-Tagged

Description :	The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24 and may play a role in macrophage lipid homeostasis. [provided by RefSeq, Jul 2008]
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	36.41 kDa
AA Sequence :	NVQFPGMAPQNLGRVDKFNSSSLMVVYTPISNLTQQIMNKTALAPLLKGTSVIGAPNKTHMDEILLENLPYAMGIIFNETFSYKLIFFQGYNSPLWK
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	ABCA6 ATP-binding cassette, sub-family A (ABC1), member 6 [ Homo sapiens ]
Official Symbol	ABCA6
Synonyms	ABCA6; ATP-binding cassette, sub-family A (ABC1), member 6; ATP-binding cassette sub-family A member 6; EST155051; ABC transporter ABCA6; ATP-binding cassette A6; FLJ43498;
Gene ID	23460
mRNA Refseq	NM_080284
Protein Refseq	NP_525023
MIM	612504
UniProt ID	Q8N139