Recombinant Human ABCA10 Protein, GST-tagged

Cat.No. : ABCA10-031H
Product Overview : Human ABCA10 partial ORF ( NP_525021, 1 a.a. - 80 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24, but neither the substrate nor the function of this gene is known. [provided by RefSeq, Jul 2008]
Molecular Mass : 34.54 kDa
AA Sequence : MNKMALASFMKGRTVIGTPDEETMDIELPKKYHEMVGVIFSDTFSYRLKFNWGYRIPVIKEHSEYTEHCWAMHGEIFCYL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABCA10 ATP-binding cassette, sub-family A (ABC1), member 10 [ Homo sapiens ]
Official Symbol ABCA10
Synonyms ABCA10; ATP-binding cassette, sub-family A (ABC1), member 10; ATP-binding cassette sub-family A member 10; EST698739; ATP-binding cassette A10;
Gene ID 10349
mRNA Refseq NM_080282
Protein Refseq NP_525021
MIM 612508
UniProt ID Q8WWZ4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ABCA10 Products

Required fields are marked with *

My Review for All ABCA10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon