Recombinant Human AASDHPPT Protein, GST-tagged

• Cat.No.: AASDHPPT-025H
• Product Overview: Human AASDHPPT full-length ORF ( AAH15470, 1 a.a. - 309 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 59.73 kDa
• AA Sequence: MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTARGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGAGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AASDHPPT aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase [ Homo sapiens ]
• Official Symbol: AASDHPPT
• Synonyms: AASDHPPT; aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase; L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase; AASD PPT; CGI 80; LYS5; LYS5 ortholog; 4-phosphopantetheinyl transferase; alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase; LYS2; CGI-80; AASD-PPT
• Gene ID: 60496
• mRNA Refseq: NM_015423
• Protein Refseq: NP_056238
• MIM: 607756
• UniProt ID: Q9NRN7