Recombinant Human AANAT Protein, GST-tagged
Cat.No. : | AANAT-021H |
Product Overview : | Human AANAT partial ORF ( NP_001079.1, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the acetyltransferase superfamily. It is the penultimate enzyme in melatonin synthesis and controls the night/day rhythm in melatonin production in the vertebrate pineal gland. Melatonin is essential for the function of the circadian clock that influences activity and sleep. This enzyme is regulated by cAMP-dependent phosphorylation that promotes its interaction with 14-3-3 proteins and thus protects the enzyme against proteasomal degradation. This gene may contribute to numerous genetic diseases such as delayed sleep phase syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009] |
Molecular Mass : | 34.43 kDa |
AA Sequence : | MSTQSTHPLKPEAPRLPPGIPESPSCQRRHTLPASEFRCLTPEDAVSAFEIEREAFISVLGVCPLYLDEIRHFLTLCPE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AANAT aralkylamine N-acetyltransferase [ Homo sapiens ] |
Official Symbol | AANAT |
Synonyms | AANAT; aralkylamine N-acetyltransferase; arylalkylamine N acetyltransferase; serotonin N-acetyltransferase; serotonin N acetyltransferase; SNAT; serotonin acetylase; arylalkylamine N-acetyltransferase; DSPS; |
Gene ID | 15 |
mRNA Refseq | NM_001088 |
Protein Refseq | NP_001079 |
MIM | 600950 |
UniProt ID | Q16613 |
◆ Recombinant Proteins | ||
AANAT-6714C | Recombinant Chicken AANAT | +Inquiry |
AANAT-2429H | Recombinant Human AANAT protein, His-tagged | +Inquiry |
AANAT-39R | Recombinant Rat AANAT Protein, His (Fc)-Avi-tagged | +Inquiry |
Aanat-07M | Recombinant Mouse Aanat Protein, His-tagged | +Inquiry |
Aanat-1990M | Recombinant Mouse Aanat protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AANAT Products
Required fields are marked with *
My Review for All AANAT Products
Required fields are marked with *
0
Inquiry Basket