Recombinant Human AADAT Protein, GST-tagged

• Cat.No.: AADAT-015H
• Product Overview: Human AADAT full-length ORF ( AAH31068.1, 1 a.a. - 429 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2013]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 74.3 kDa
• AA Sequence: MNYARFITAASAARNPSPIRTMSEKRADILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYQPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AADAT aminoadipate aminotransferase [ Homo sapiens ]
• Official Symbol: AADAT
• Synonyms: AADAT; aminoadipate aminotransferase; kynurenine/alpha-aminoadipate aminotransferase, mitochondrial; KAT2; KATII; kynurenine aminotransferase II; L kynurenine/alpha aminoadipate aminotransferase; KAT/AadAT; 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; alpha-aminoadipate aminotransferase; kynurenine--oxoglutarate transaminase II; kynurenine--oxoglutarate aminotransferase II
• Gene ID: 51166
• mRNA Refseq: NM_016228
• Protein Refseq: NP_057312
• MIM: 611754
• UniProt ID: Q8N5Z0