Recombinant Human A1CF protein, His-tagged

• Cat.No.: A1CF-3507H
• Product Overview: Recombinant Human A1CF protein(1-122 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 1-122 aa
• AA Sequence: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIR
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: A1CF APOBEC1 complementation factor [ Homo sapiens ]
• Official Symbol: A1CF
• Synonyms: A1CF; APOBEC1 complementation factor; ACF; ACF64; ACF65; APOBEC1CF; ASP; apo-B RNA editing protein; APOBEC-1 stimulating protein; apobec-1 complementation factor (ACF) (ASP); RP11-564C4.2; MGC163391
• Gene ID: 29974
• mRNA Refseq: NM_001198818
• Protein Refseq: NP_001185747
• UniProt ID: Q9NQ94