Recombinant HPV18 L1 Protein

• Cat.No.: HPV18-L1-04H
• Product Overview: Recombinant HPV18 L1 Protein without tag was expressed in E.coli.

Specification

• Species: HPV18
• Source: E.coli
• Description: L1 is a major capsid protein of type 18 human papilloma virus. Infection with specific types of HPV has been associated with an increased risk of developing cervical neoplasia. HPV types 6 and 11 have been associated with relatively benign diseases such as genital warts but types 16 and 18 are strongly associated with cervical, vaginal, and vulvar malignancies.
• Molecular Mass: 58.9 kDa
• AA Sequence: MRNVNVFPIFLQMALWRPSDNTVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPAKRVRVRARKHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL method
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.4 mg/mL
• Storage Buffer: PBS, 0.05% SKL, pH 7.4

Gene Information

• Synonyms: L1; HPV18 major capsid protein L1; Human papilloma virus type 18 major capsid protein L1; Human papillomavirus type 18 L1; Human papillomavirus type 18 major capsid protein L1; Major capsid protein L1