Recombinant HPV18 E6 Protein, His-tagged

Cat.No. : E6-1682H
Product Overview : Recombinant HPV18 E6 protein (1-158aa) with N-His tag was expressed in E. coli.
Availability April 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : HPV18
Source : E.coli
Tag : His
Protein Length : 1-158aa
Description : Plays a major role in the induction and maintenance of cellular transformation. Acts mainly as an oncoprotein by stimulating the destruction of many host cell key regulatory proteins. E6 associates with host UBE3A/E6-AP ubiquitin-protein ligase, and inactivates tumor suppressors TP53 and TP73 by targeting them to the 26S proteasome for degradation. In turn, DNA damage and chromosomal instabilities increase and lead to cell proliferation and cancer development. The complex E6/E6AP targets several other substrates to degradation via the proteasome including host DLG1 or NFX1, a repressor of human telomerase reverse transcriptase (hTERT). The resulting increased expression of hTERT prevents the shortening of telomere length leading to cell immortalization. Other cellular targets including BAK1, Fas-associated death domain-containing protein (FADD) and procaspase 8, are degraded by E6/E6AP causing inhibition of apoptosis. E6 also inhibits immune response by interacting with host IRF3 and TYK2. These interactions prevent IRF3 transcriptional activities and inhibit TYK2-mediated JAK-STAT activation by interferon alpha resulting in inhibition of the interferon signaling pathway.
Tag : N-His
Molecular Mass : 21 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDSIPHAACHKCIDFYSRIRELRHYSDSVYGDTLEKLTNTGLYNLLIRCLRCQKPLNPAEKLRHLNEKRRFHNIAGHYRGQCHSCCNRARQERLQRRRETQV
Purity : > 95 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.1 mg/mL by BCA
Storage Buffer : Sterile PBS, pH7.4, 0.05% SKL
Gene Name E6 E6 protein [ human papillomavirus 18 ]
Official Symbol E6
Synonyms E6; E6 protein
Gene ID 1489088
Protein Refseq NP_040310
UniProt ID P06463

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All E6 Products

Required fields are marked with *

My Review for All E6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon