Recombinant HPV-16 E6 protein, His-tagged

• Cat.No.: E6-03H
• Product Overview: Recombinant HPV-16 E6 protein(P03126)(1-158aa), fused with His tag, was expressed in E.coli.

Specification

• Species: HPV16
• Source: E.coli
• Tag: His
• Protein Length: 1-158aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 23.2 kDa
• AA Sequence: MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 mg/ml. Centrifuge the vial at 4℃ before opening to recover the entire contents.