Recombinant HPV16 protein E6*;transforming protein E6, His tagged

• Cat.No.: E6-14H
• Product Overview: Protein E6, HPV16 (His, 1-158aa) is the recombinant Virus-derived protein E6, HPV16, expressed by E. coli , with N-6×His labeled tag.

Specification

• Description: Protein E6 is one of three cancer proteins encoded by human papillomavirus (HPV). The binding of Protein E6 to ubiquitin protein ligase can inhibit the expression of p53. Protein E6 suppresses the immune response through the JAK-STAT signaling pathway. Protein E6 can promote cell proliferation and inhibit cell apoptosis.
• Source: E. coli
• Species: HPV16
• Tag: N-6×His
• Protein length: 1-158aa
• Form: Lyophilized Powder
• Bio-activity: Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is < 6.8 ng/mL, corresponding to a specific activity is > 1.47×10^5 units/mg.
• Molecular Mass: 22 kDa (monomer), 44 kDa (dimer)
• AA Sequence: MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL
• Endotoxin: < 1 EU/μg, determined by LAL method.
• Storage: Store at -20 centigrade for 2 years. After reconstitution, it is stable at 4 centigrade for 1 week or -20 centigrade for longer (with carrier protein). It is recommended to freeze aliquots at -20 or -80 centigrade for extended storage.
• Storage Buffer: Lyophilized from 0.22 μm filtered solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCl, 500 mM arginine, pH 8.0.
• Shipping: Room temperature in continental US; may vary elsewhere.
• Reconstitution: It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Gene Information

• Gene Name: E6 protein E6*;transforming protein E6 [ Human papillomavirus 16 ]
• Official Symbol: E6
• Synonyms: E6; protein E6*;transforming protein E6; Oncoprotein. It has long been recognized as a potent oncogene and is intimately associated with the events that result in the malignant conversion of virally infected cells; Spliced. E6*. Function is not known yet.
• Gene ID: 1489078
• Protein Refseq: NP_041325
• UniProt ID: P03126