Recombinant Horse MMP9 protein
Cat.No. : | MMP9-6754H |
Product Overview : | Recombinant Horse MMP9 protein(F7AGL5)(20-640aa) was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Horse |
Source : | Yeast |
Tag : | Non |
Protein Length : | 20-640aa |
Tag : | Non |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 69.0 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | APTRHQPTVVVFPGDLLTNLTDRELAEEYLFRYGYTGVAEMSEGDQPLERALRRLQKRLALPETGELDSTTLEAMRTPRCGVPDVGQFQTFEGDLKWHHRDITYWIQNYSGDLPRDVIDDAFARAFAVWSEVTPLTFTRVNGPQADIVIQFGVREHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDEELWSLGKGPVVPTHFGNADGAPCHFPFTFEGRSYSSCTTDGRSDDMLWCSTTADYDTDRRFGFCPSEKLYTQDGNADGKPCVFPFTFEGRSYSTCTTDGRSDGYRWCATTANYDQDKRYGFCPTRVDSTVNGGNSAGELCVFPFTFLGKEYSACTREGRSDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPAALMYPMYSFTEEPPLHEDDVNGIQYLYGPRPKPEPQPPTTTTLEPQTTVCATGPPTTRPSERPTAGPTGPPSAGPTGPPSAGPPTNPPTAGPSTAPTVPLGPGEEVCNVDIFDAIAEIGNHLHFFKDGRYWRLLEGKGRGVQGPFLIRDTWPMLPPKLDSAFEEPLTKKIFFFSGRQVWVYTGKSALGPRRLDKLGLGADVAQITGALPRGGGKVLLFSRRRFW |
Gene Name | MMP9 matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase) [ Equus caballus ] |
Official Symbol | MMP9 |
Synonyms | MMP9; matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase); matrix metalloproteinase-9; matrix metalloproteinase 9; |
Gene ID | 100056599 |
mRNA Refseq | NM_001111302 |
Protein Refseq | NP_001104772 |
◆ Recombinant Proteins | ||
Mmp9-37H | Active Recombinant Rat Mmp9 protein (20-708aa), C-6×His-tagged | +Inquiry |
MMP9-429H | Recombinant Human MMP9 protein, His-tagged | +Inquiry |
MMP9-3720R | Recombinant Rat MMP9 Protein | +Inquiry |
MMP9-811H | Recombinant Human MMP9 protein, His-tagged | +Inquiry |
MMP9-1403HFL | Recombinant Full Length Human MMP9 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
MMP9-39H | Native Human MMP-9/Lipocalin Complex | +Inquiry |
MMP9-38H | Native Human MMP-9 | +Inquiry |
MMP9-9810 | Active Native Human MMP9 | +Inquiry |
MMP9-41H | Native Human MMP-9/TIMP-1 Complex | +Inquiry |
MMP9-29698TH | Native Human MMP9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP9-2560HCL | Recombinant Human MMP9 cell lysate | +Inquiry |
MMP9-2026MCL | Recombinant Mouse MMP9 cell lysate | +Inquiry |
MMP9-1940RCL | Recombinant Rat MMP9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MMP9 Products
Required fields are marked with *
My Review for All MMP9 Products
Required fields are marked with *
0
Inquiry Basket