Recombinant HIV tat protein Clade-B

Cat.No. : tat-189H
Product Overview : HIV-1 TAT Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 86 amino acids encoded by two exons and having chain having a molecular mass of 14kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : HIV
Source : E.coli
Tag : Non
Protein Length : 86 amino acids
Description : Human immunodeficiency virus type-1 (HIV-1) regulatory Tat protein plays an essential role in viral replication (Jones KA, 1994) and infectivity (Arya SK, 1985; Fisher AG, 1986). In addition, during acute infection, Tat is released extracellularly by infected cells (Chang HC, 1997; Ensoli B, 1990) and is taken up by neighboring cells where it transactivates viral replication (Ensoli B, 1993) and increases virus infectivity.
HIV-1 Tat activates transcription of HIV-1 viral genes by inducing phosphorylation of the C-terminal domain (CTD) of RNA polymerase II (RNAPII). Tat can also disturb cellular metabolism by inhibiting proliferation of antigen-specific T lymphocytes and by inducing cellular apoptosis. Tat-induced apoptosis of T-cells is attributed, in part, to the distortion of microtubules polymerization. LIS1 is a microtubule-associated protein that facilitates microtubule polymerization.
Form : Sterile Filtered and lyophilized, though might appear as a solution as a result of the glycerol content. Lyophilized with 0.1% glycerol.
Molecular Mass : 14kDa
AA sequence : MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRPPQGSQTHQVSLSKQPTSQSRGDPTGPKE.
Purity : Greater than 90.0% as determined by SDS-PAGE.
Usage : The products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Stability : Lyophilized HIV-1 TAT although stable at room temperature for 1 week, should be stored desiccated below -18°C. Upon reconstitution HIV-1 TAT should be stored at 4°C between 2-7 days and for future use below -18°C. For long-term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Specificity : Immunoreactive with all sera of HIV-1 infected individuals.
Solubility : It is recommended to reconstitute the lyophilized HIV-1 TAT in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Gene Name tat p14 [ Human immunodeficiency virus 1 ]
Official Symbol tat
Synonyms tat; p14
Gene ID 155871
Protein Refseq NP_057853.1
UniProt ID P04608

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All tat Products

Required fields are marked with *

My Review for All tat Products

Required fields are marked with *

0

Inquiry Basket

cartIcon