Recombinant HHV-5(strain Towne) UL132 protein, MBP&His-Avi-tagged, Biotinylated

• Cat.No.: UL132-343H
• Product Overview: Biotinylated Recombinant HHV-5(strain Towne) UL132 protein(P69339)(157-270aa), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E.coli.

Specification

• Species: HHV-5(strain Towne)
• Source: E.coli
• Tag: N-MBP&C-His-Avi
• ProteinLength: 157-270aa
• Conjugation/Label: Biotin
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 61.1 kDa
• AASequence: SPYQRLETRDWDEEEEASAARERMKHDPENVIYFRKDGNLDTSFVNPNYGRGSPLTIESHLSDNEEDPIRYYVSVYDELTASEMEEPSNSTSWQIPKLMKVAMQPVSLRDPEYD
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.