Recombinant HHV-2 UL49 Protein, His-tagged

• Cat.No.: UL49-1394H
• Product Overview: Recombinant HHV-2 UL49 Protein (170-300aa) was expressed in E. coli with N-terminal His tag.

Specification

• Species: HHV2
• Source: E.coli
• Tag: His
• ProteinLength: 170-300 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 17.9 kDa
• AA Sequence: GLAKKLHFSTAPPSPTAPWTPRVAGFNKRVFCAAVGRLAATHARLAAVQLWDMSRPHTDEDLNELLDLTT
  IRVTVCEGKNLLQRANELVNPDAAQDVDATAAARGRPAGRAAATARAPARSASRPRRPLE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: UL49 involved in virion morphogenesis; possibly involved in RNA transport to uninfected cells [ Human herpesvirus 2 ]
• Official Symbol: UL49
• Synonyms: UL49; Tegument protein VP22
• Gene ID: 1487336
• Protein Refseq: YP_009137201.1
• UniProt ID: P89468