Recombinant Hepatitis C Virus HCVgp1 protein, His-tagged

• Cat.No.: HCVgp1-85H
• Product Overview: Recombinant HCV Core 1-120 produced in E. coli is a single polypeptide chain containing 140 amino acids (aa 1-120) and having a molecular mass of 15.7kDa. Recombinant HCV Core 1-120 is fused to a 20 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

Specification

• Description: HCV is a small 50nm, enveloped, single-stranded, positive sense RNA virus in the family Flaviviridae. HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes (1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6).
• Source: E. coli
• Species: Hepatitis C Virus
• Tag: His
• Form: Sterile filtered colorless solution. The HCV Core protein solution (0.5mg/ml) contains 20mM Tris-HCl buffer (pH 8.0), 0.4M Urea and 10% glycerol.
• Molecular Mass: 15.7kDa
• Protein length: 140 amino acids (aa 1-120)
• AA sequence: MGSSHHHHHHSSGLVPRGSHMSTNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRPEGRTWAQPGYPWPLYGNEGCGWAGWLLSPRGSRPSWGPTDPRRRSRNLG.
• Purity: Greater than 85% as determined by SDS-PAGE.
• Usage: The products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
• Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
• Shipping: Ice Packs

Gene Information

• Gene Name: HCVgp1 polyprotein [ Hepatitis C virus ]
• Official Symbol: HCVgp1
• Synonyms: polyprotein; core protein; E1 protein; E2 protein; p7 protein; NS2 protein; NS3 protease/helicase; NS4A protein; NS4B protein; NS5A protein; NS5B RNA-dependent RNA polymerase; HCVgp1
• Gene ID: 951475
• Protein Refseq: NP_671491.1