Recombinant Hepatitis B virus X Protein

• Cat.No.: HBx-3258V
• Product Overview: Hepatitis B Virus Protein X is a 17.8kDa protein containing 165 amino acid residues and purified by proprietary chromatographic techniques.

Specification

• Species: Hepatitis B Virus
• Source: E.coli
• Tag: His
• Form: Filtered (0.4µm) and lyophilized from 0.5mg/ml in 50mM acetate buffer pH4 and 5% trehalose.
• Molecular Mass: 17.8kDa
• AA Sequence: MRGSHHHHHHGSAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
• Purity: Greater than 90%
• Storage: For long term storage lyophilized protein should be stored at -20 centigrade. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 centigrade for a limited period of time; it does not show any change after two weeks at 4 centigrade.
• Reconstitution: It is recommended to add 0.1M Acetate buffer pH4 to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 µg/ml. In higher concentrations the solubility of the HBV X antigen is limited. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.