Recombinant Helicobacter Pylori VACA Protein (37-245 aa), His-tagged
Cat.No. : | VACA-1270H |
Product Overview : | Recombinant Helicobacter Pylori (strain ATCC 700392/26695) (Campylobacter pylori) VACA Protein (37-245 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Helicobacter Pylori |
Source : | E.coli |
Tag : | His |
Protein Length : | 37-245 aa |
Description : | Induces vacuolation of eukaryotic cells. Causes ulceration and gastric lesions. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 26.6 kDa |
AA Sequence : | TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQWNKLEVDMKDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Synonyms | vacA; |
UniProt ID | P55981 |
◆ Recombinant Proteins | ||
vacA-4050C | Recombinant Campylobacter pylori vacA protein, His-B2M-tagged | +Inquiry |
vacA-1398H | Recombinant H. pylori vacA Protein, His-SUMO-tagged | +Inquiry |
vacA-5286C | Recombinant Campylobacter pylori vacA protein, His-tagged | +Inquiry |
VACA-1270H | Recombinant Helicobacter Pylori VACA Protein (37-245 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VACA Products
Required fields are marked with *
My Review for All VACA Products
Required fields are marked with *
0
Inquiry Basket