Recombinant Helicobacter Pylori GLTX1 Protein (1-463 aa), His-SUMO-tagged
Cat.No. : | GLTX1-865H |
Product Overview : | Recombinant Helicobacter Pylori (strain ATCC 700392/26695) GLTX1 Protein (1-463 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Helicobacter Pylori |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-463 aa |
Description : | Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu). |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 69.4 kDa |
AA Sequence : | MSLIVTRFAPSPTGYLHIGGLRTAIFNYLFARANQGKFFLRIEDTDLSRNSIEAANAIIEAFKWVGLEYDGEILYQSKRFEIYKEYIQKLLDEDKAYYCYMSKEELDALREEQKARKETPRYDNRYRDFKGTPPKGIEPVVRIKVPQNEVIGFNDGVKGEVKVNTNELDDFIIARSDGTPTYNFVVTIDDALMGITDVIRGDDHLSNTPKQIVLYKALNFKIPNFFHVPMILNEEGQKLSKRHGATNVMDYQEMGYLKEALVNFLARLGWSYQDKEVFSMQELLELFDPKDLNSSPSCFSWHKLNWLNAHYLKNQSVQELLKLLKPFSFSDLSHLNPTQLDRLLDALKERSQTLKELALKIDEVLIAPVEYEEKVFKKLNQALVMPLLEKFKLELNKANFNDESALENAMRQIIEEEKIKAGSFMQPLRLALLGKGGGIGLKEALFILGKTESVKRIEDFLKN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
UniProt ID | P96551 |
◆ Recombinant Proteins | ||
GLTX1-1565H | Recombinant Helicobacter Pylori GLTX1 Protein (1-463 aa), His-tagged | +Inquiry |
GLTX1-865H | Recombinant Helicobacter Pylori GLTX1 Protein (1-463 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLTX1 Products
Required fields are marked with *
My Review for All GLTX1 Products
Required fields are marked with *
0
Inquiry Basket