Recombinant Haemophilus influenzae oapA Protein
| Cat.No. : | oapA-102H |
| Product Overview : | Recombinant Haemophilus influenzae oapA Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Haemophilus influenzae |
| Source : | E.coli |
| Description : | Opacity-associated protein OapA |
| Form : | Liquid. In 50 mM NaH2PO4 buffer (pH8.0) containing 300 mM NaCl. |
| Molecular Mass : | ~31.7 kDa |
| AA Sequence : | KPSSDTVESFTQSNSNEVPVQFQSLDQSQPLETTILDNPPAQNQMAVEQANQSEFAPKAEEAANNTTAQNPLVENAPMQQNVVQSPSQMPNEMAAASVMPMQPAQAEQPKATVPVQPMKKAVEPQVAHKDTVKKEVKVAENAQAPSKATEQNVAKTAGNAPIVEAKPVQVKKEKKVQIVDAKPVSKSAASRLSAKTLTVPKGVSLMQVFRDNQLNISDVNAMSKAAGAGNVLSSFKSGDKVTVSVNNQGRVNEMRLSNGARFVRQSDGSYQYKK |
| Purity : | >85% |
| Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 0.5 mg/ml |
| Official Symbol | oapA |
| UniProt ID | P44415 |
| ◆ Recombinant Proteins | ||
| oapA-102H | Recombinant Haemophilus influenzae oapA Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All oapA Products
Required fields are marked with *
My Review for All oapA Products
Required fields are marked with *
0
Inquiry Basket
