Recombinant Haemophilus influenzae HI_1339 Protein

• Cat.No.: HI_1339-111H
• Product Overview: Recombinant Haemophilus influenzae HI_1339 Protein was expressed in E. coli.

Specification

• Species: Haemophilus influenzae
• Source: E.coli
• Description: Uncharacterized protein HI_1339/HI_1462.1
• Form: Liquid. In 50 mM NaH2PO4 buffer (pH8.0) containing 300 mM NaCl.
• Molecular Mass: ~20.5 kDa
• AA Sequence: CFDKQEAKQKVEDTKQTVASVASETKDAAANTMTEVKEKAQQLSTDVKNKVAEKVEDAKEVIKSATETASEKATEIKEAVSEKASEMKEAASEKASEMKEAASEKASEMKEAASEKASEMKEAASEKASEMKEAASEKVGEMKEKATEMKEAVSEKATQAVDAVKEATK
• Purity: >85%
• Storage: Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.44 mg/ml

Gene Information

• Official Symbol: HI_1339
• UniProt ID: P71378