Recombinant H. pylori HP0887 Protein, His-tagged
Cat.No. : | HP0887-1399H |
Product Overview : | Recombinant H. pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) HP0887 Protein (37-245aa) was expressed in E. coli with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | H.pylori |
Source : | E.coli |
Tag : | His |
ProteinLength : | 37-245 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 26.6 kDa |
AA Sequence : | TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLS SKIDGGWDWGNAATHYWVKGGQWNKLEVDMKDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFT SYKDSADRTTRVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | HP0887 vacuolating cytotoxin autotransporter [ Helicobacter pylori 26695 ] |
Official Symbol | HP0887; vacuolating cytotoxin autotransporter; vacA; Vacuolating cytotoxin; Vacuolating cytotoxin translocator |
Synonyms | HP0887 |
Gene ID | 899415 |
Protein Refseq | NP_207680.1 |
UniProt ID | P55981 |
◆ Recombinant Proteins | ||
MKNK1-4292HF | Active Recombinant Full Length Human MKNK1 Protein, DDK-tagged, Biotinylated | +Inquiry |
RALB-4916R | Recombinant Rat RALB Protein | +Inquiry |
TMEM70-2071C | Recombinant Chicken TMEM70 | +Inquiry |
OBP2A-136H | Recombinant Human OBP2A protein, MYC/DDK-tagged | +Inquiry |
RFL23679RF | Recombinant Full Length Rhodospirillum Centenum Protein Crcb Homolog(Crcb) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IGHA2-615H | Native Human Immunoglobulin Heavy Constant Alpha 2 (A2m marker) | +Inquiry |
ACTC1-885B | Native Bovine ACTC1 Protein, Pyrene labeled | +Inquiry |
S100A9-3179H | Native Human S100A9 protein(Met1-Pro114) | +Inquiry |
Fibronectin-13R | Native Rat Fibronectin Protein | +Inquiry |
TG-393H | Native Human Thyroglobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
GREM2-5752HCL | Recombinant Human GREM2 293 Cell Lysate | +Inquiry |
ZNF165-138HCL | Recombinant Human ZNF165 293 Cell Lysate | +Inquiry |
CDH8-2738HCL | Recombinant Human CDH8 cell lysate | +Inquiry |
Pituitary-726P | Pig Pituitary Lysate, Total Protein | +Inquiry |
ATXN1-8566HCL | Recombinant Human ATXN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HP0887 Products
Required fields are marked with *
My Review for All HP0887 Products
Required fields are marked with *
0
Inquiry Basket