Recombinant H. alvei Intimin Protein, His-SUMO-tagged
Cat.No. : | eaeA-1196H |
Product Overview : | Recombinant Hafnia alvei Intimin Protein (1-280aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | H.alvei |
Source : | E.coli |
Tag : | His&SUMO |
ProteinLength : | 1-280 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 46.1 kDa |
AA Sequence : | ITEIKADKTTAVANGKDAVTYTVKVMKDGKPLSGEEVTFTTTLGTLSKSTEKTNTNGYRKVSLTSANQGKSLVSASVTMPQLMLKLLEVEFFTQLTIDNGNVEIVGTGAKGKLPNVWLQYGQVNLKANGGNGKYTWYSANPAIASVDPSSGQVTLKDKGETTITVVSGDKQTAIYTIAMPNSIVSVNSSGRVDYNTANNICKNIKGSLPSSIKELKDLYDDWGAANKYQHYSQESITAWTLQTSENKVQGVASTYDLVRKNPLIDKVDIAGNYAYAVCVK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Intimin |
Official Symbol | Intimin |
Synonyms | Intimin; Attaching and effacing protein; Outer membrane protein; eaeA; P52869 |
UniProt ID | P52869 |
◆ Recombinant Proteins | ||
YUSQ-2604B | Recombinant Bacillus subtilis YUSQ protein, His-tagged | +Inquiry |
SERPINB2-1515R | Recombinant Rat SERPINB2 Protein (1-416 aa), His-tagged | +Inquiry |
GDF15-284H | Recombinant Human GDF15 protein, His-tagged | +Inquiry |
PARP16-5095HFL | Recombinant Full Length Human PARP16 protein, Flag-tagged | +Inquiry |
DRD1-10H | Recombinant Human DRD1 | +Inquiry |
◆ Native Proteins | ||
ctxB-146V | Native Cholera Toxin B | +Inquiry |
gG2-650V | Native Herpes Simplex Virus gG2 Protein | +Inquiry |
HbA1c-199H | Native Human Hemoglobin A1C | +Inquiry |
VCL-899T | Native Turkey VCL Protein | +Inquiry |
IgY-006D | Native Duck IgY | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEUROD2-3867HCL | Recombinant Human NEUROD2 293 Cell Lysate | +Inquiry |
AXIN2-8554HCL | Recombinant Human AXIN2 293 Cell Lysate | +Inquiry |
Heart Ventricle-223H | Human Heart Ventricle (RT) Lysate | +Inquiry |
SETDB1-1923HCL | Recombinant Human SETDB1 293 Cell Lysate | +Inquiry |
UBE2T-561HCL | Recombinant Human UBE2T 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Intimin Products
Required fields are marked with *
My Review for All Intimin Products
Required fields are marked with *
0
Inquiry Basket