Recombinant Guinea Pig CXCL10 Protein
Cat.No. : | CXCL10-54G |
Product Overview : | Recombinant Guinea Pig CXCL10 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Guinea Pig |
Source : | E.coli |
Description : | Interferon gamma-induced protein 10 (IP-10), or CXCL10, is a chemokine secreted by monocytes, endothelial cells and fibroblasts in response to interferon gamma (IFN-‰£). IP-10 functions as a chemoattractant for activated T cells, monocytes, dendritic, and natural killer (NK) cells that express the G protein-coupled receptor CXCR3. IP-10 is an important factor in autoimmune diseases such as Hashimoto’s thyroiditis, Graves’ disease, and Type 1 diabetes mellitus. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 8.7 kDa (76 aa) |
AA Sequence : | IPHSRTIRCTCIETSTQPVNPKSFKKLEIIPASQSCPRVEIIATMKMNGEKRCLDPESKVIKNLLKAVRKERSKRS |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Cxcl10 C-X-C motif chemokine ligand 10 [ Cavia porcellus (domestic guinea pig) ] |
Official Symbol | CXCL10 |
Synonyms | Cxcl10; C-X-C motif chemokine ligand 10; C-X-C motif chemokine 10 |
Gene ID | 100714889 |
mRNA Refseq | XM_003477649 |
Protein Refseq | XP_003477697 |
UniProt ID | A0A286XCT1 |
◆ Recombinant Proteins | ||
CXCL10-69F | Recombinant Feline CXCL10 (IP-10) | +Inquiry |
CXCL10-08H | Recombinant Human CXCL10 protein | +Inquiry |
CXCL10-211H | Active Recombinant Human Chemokine (C-X-C Motif) Ligand 10, MIgG2a Fc-tagged | +Inquiry |
CXCL10-31H | Recombinant Human CXCL10, His-tagged | +Inquiry |
CXCL10-86R | Recombinant Rat CXCL10 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL10-7172HCL | Recombinant Human CXCL10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCL10 Products
Required fields are marked with *
My Review for All CXCL10 Products
Required fields are marked with *
0
Inquiry Basket