Recombinant Golden hamster Il10 protein, His&Strep II-tagged
Cat.No. : | Il10-6342G |
Product Overview : | Recombinant Golden hamster Il10 protein(A0A1U7QIX2)(22-178aa), fused with N-terminal His tag and C-terminal Strep II tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Golden hamster |
Source : | E.coli |
Tag : | His&Strep II |
Protein Length : | 22-178a.a. |
Tag : | His&Strep II |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.6 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | QYTQHESNCTHFPVSQTHMLRELRTAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQTLSEMIQFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLRRQLQRCHRFLPCENKSKAVEQVKDNFNKLQEKGVFKAMNEFDIFINCIEVYMTIKMKS |
◆ Recombinant Proteins | ||
Il10-006I | Active Recombinant Rat Il10 Protein (160 aa) | +Inquiry |
IL10-79P | Recombinant Porcine Interleukin 10 | +Inquiry |
IL10-996P | Recombinant Pig IL10 Protein, His&GST-tagged | +Inquiry |
IL10-204P | Active Recombinant Pig IL10 Protein (Ser19-Asn175), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL10-569P | Active Recombinant Pig IL10 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il10 Products
Required fields are marked with *
My Review for All Il10 Products
Required fields are marked with *
0
Inquiry Basket