Recombinant GFP Protein
Cat.No. : | GFP-02 |
Product Overview : | Recombinant GFP Protein was expressed in E. coli. |
Availability | February 07, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli |
Description : | Protein NARROW LEAF 1 |
Form : | Supplied as a 0.2 μm filtered solution in 10 mM PBS (pH 7.4). |
AA Sequence : | SMSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Endotoxin : | <1.0 EU per ug (determined by the LAL method) |
Purity : | >95% by SDS-PAGE |
Storage : | Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.4 mg/ml |
Gene Name | NAL1 Protein NARROW LEAF 1 [ Oryza sativa Japonica Group (Japanese rice) ] |
Official Symbol | GFP |
Synonyms | GFP; SPIKE; qFLW4; LSCHL4; OsJ_16147 |
Gene ID | 4336986 |
mRNA Refseq | NM_001419864.1 |
Protein Refseq | NP_001406793.1 |
UniProt ID | P42212 |
◆ Recombinant Proteins | ||
Map3k7cl-1474M | Recombinant Mouse Map3k7cl protein, His-tagged | +Inquiry |
CCDC137-2840M | Recombinant Mouse CCDC137 Protein | +Inquiry |
RFL16176AF | Recombinant Full Length Acaryochloris Marina Photosystem Ii Reaction Center Protein Z(Psbz) Protein, His-Tagged | +Inquiry |
FBP1-4248H | Recombinant Human FBP1 protein, GST-tagged | +Inquiry |
RFL4984MF | Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 82(Gpr82) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
TF-31158TH | Native Human TF | +Inquiry |
Lectin-1870W | Active Native Wisteria Floribunda Lectin Protein, Fluorescein labeled | +Inquiry |
GPT-5344H | Native Human Glutamic-Pyruvate Transaminase (alanine aminotransferase) | +Inquiry |
AC-63B | Native Bovine Activated Protein C | +Inquiry |
Lectin-1746M | Active Native Maackia Amurensis Lectin I Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
L3MBTL3-4833HCL | Recombinant Human L3MBTL3 293 Cell Lysate | +Inquiry |
CLEC4B2-859RCL | Recombinant Rat CLEC4B2 cell lysate | +Inquiry |
PKNOX1-3148HCL | Recombinant Human PKNOX1 293 Cell Lysate | +Inquiry |
HARS2-5634HCL | Recombinant Human HARS2 293 Cell Lysate | +Inquiry |
NECAB1-3889HCL | Recombinant Human NECAB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GFP Products
Required fields are marked with *
My Review for All GFP Products
Required fields are marked with *
0
Inquiry Basket