Recombinant GFP Protein
Cat.No. : | GFP-02 |
Product Overview : | Recombinant GFP Protein was expressed in E. coli. |
Availability | April 19, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli |
Description : | Protein NARROW LEAF 1 |
Form : | Supplied as a 0.2 μm filtered solution in 10 mM PBS (pH 7.4). |
AA Sequence : | SMSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Endotoxin : | <1.0 EU per ug (determined by the LAL method) |
Purity : | >95% by SDS-PAGE |
Storage : | Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.4 mg/ml |
Gene Name | NAL1 Protein NARROW LEAF 1 [ Oryza sativa Japonica Group (Japanese rice) ] |
Official Symbol | GFP |
Synonyms | GFP; SPIKE; qFLW4; LSCHL4; OsJ_16147 |
Gene ID | 4336986 |
mRNA Refseq | NM_001419864.1 |
Protein Refseq | NP_001406793.1 |
UniProt ID | P42212 |
◆ Recombinant Proteins | ||
GFP-301136 | Recombinant GFP protein, GST-tagged | +Inquiry |
GFP-5647J | Recombinant Jellyfish GFP protein, His-tagged | +Inquiry |
GFP-27H | Active Recombinant EGFP-rProtein A, His-tagged | +Inquiry |
GFP-01 | Recombinant GFP Protein | +Inquiry |
GFP-02 | Recombinant GFP Protein | +Inquiry |
◆ Native Proteins | ||
GFP-36B | Native Bovine GFP | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GFP Products
Required fields are marked with *
My Review for All GFP Products
Required fields are marked with *
0
Inquiry Basket