Recombinant Full Length Zygosaccharomyces Rouxii Altered Inheritance Of Mitochondria Protein 43, Mitochondrial(Aim43) Protein, His-Tagged
Cat.No. : | RFL32968ZF |
Product Overview : | Recombinant Full Length Zygosaccharomyces rouxii Altered inheritance of mitochondria protein 43, mitochondrial(AIM43) Protein (C5DYQ1) (29-176aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zygosaccharomyces rouxii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (29-176) |
Form : | Lyophilized powder |
AA Sequence : | YCPLKSSQGTDIKSLEDLTKLKSLEGVDPELIRKLINERTIELNVQNELEMLKNLNKQEK MSQEVSLKRFVRPLWVFFLMSSTVYLILHYVWWKLEVVEKEKELQSHVESLEMELDQTLK SQNQNVSSSQNNGNNKTNDKPWYRKWFF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | INA17 |
Synonyms | INA17; ZYRO0F14828g; Inner membrane assembly complex subunit 17 |
UniProt ID | C5DYQ1 |
◆ Recombinant Proteins | ||
CSF2-2157HF | Recombinant Full Length Human CSF2 Protein, GST-tagged | +Inquiry |
YARS-3776H | Recombinant Human YARS protein, GST-tagged | +Inquiry |
MAPKAPK2-27129TH | Recombinant Human MAPKAPK2 | +Inquiry |
TM4SF1-2942H | Active Recombinant Human TM4SF1 Full Length Transmembrane protein(MNP) | +Inquiry |
BET1-2379M | Recombinant Mouse BET1 Protein | +Inquiry |
◆ Native Proteins | ||
PTI-29B | Active Native Bovine Aprotinin | +Inquiry |
ATF-180M | Native Mouse Apotransferrin | +Inquiry |
CHOD-22 | Active Native Cholesterol esterase | +Inquiry |
DIS-2019 | Active Alpha-Cyclomaltodextrin glucanotransferase | +Inquiry |
IGHG3-120H | Native Human Immunoglobulin G3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR44-5785HCL | Recombinant Human GPR44 293 Cell Lysate | +Inquiry |
PC-3406HCL | Recombinant Human PC 293 Cell Lysate | +Inquiry |
SCAMP5-576HCL | Recombinant Human SCAMP5 lysate | +Inquiry |
TEK-1511MCL | Recombinant Mouse TEK cell lysate | +Inquiry |
U1SNRNPBP-610HCL | Recombinant Human U1SNRNPBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All INA17 Products
Required fields are marked with *
My Review for All INA17 Products
Required fields are marked with *
0
Inquiry Basket