Recombinant Full Length Zygnema Circumcarinatum Cytochrome B559 Subunit Alpha(Psbe) Protein, His-Tagged
Cat.No. : | RFL15571ZF |
Product Overview : | Recombinant Full Length Zygnema circumcarinatum Cytochrome b559 subunit alpha(psbE) Protein (Q32RJ5) (1-83aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zygnema circumcarinatum (Green alga) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-83) |
Form : | Lyophilized powder |
AA Sequence : | MSGNTGERPFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QEIPLITGRFNSLEQLDEFTRAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbE |
Synonyms | psbE; Cytochrome b559 subunit alpha; PSII reaction center subunit V |
UniProt ID | Q32RJ5 |
◆ Recombinant Proteins | ||
PBXIP1-4289R | Recombinant Rat PBXIP1 Protein | +Inquiry |
GCSH-6276M | Recombinant Mouse GCSH Protein | +Inquiry |
RANGAP1-7416M | Recombinant Mouse RANGAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCL5-2198H | Recombinant Human CXCL5 Protein (Leu44-Asn114) | +Inquiry |
KIT-396HAF488 | Recombinant Human KIT Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Native Proteins | ||
PNLIP-8203H | Native Human Pancreatic Lipase | +Inquiry |
FTH1-1868H | Native Human Ferritin, Heavy Polypeptide 1 | +Inquiry |
PLG-1867B | Native Bovine PLG Protein | +Inquiry |
ORM1-5323H | Native Human Orosomucoid 1 | +Inquiry |
Ngf-298M | Active Native Mouse Nerve Growth Factor | +Inquiry |
◆ Cell & Tissue Lysates | ||
Ileum-248H | Human Ileum Membrane Lysate | +Inquiry |
CD180-2224MCL | Recombinant Mouse CD180 cell lysate | +Inquiry |
HSD11B2-5378HCL | Recombinant Human HSD11B2 293 Cell Lysate | +Inquiry |
HIST1H2BK-5537HCL | Recombinant Human HIST1H2BK 293 Cell Lysate | +Inquiry |
Skin-849P | Pig Skin Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbE Products
Required fields are marked with *
My Review for All psbE Products
Required fields are marked with *
0
Inquiry Basket