Recombinant Full Length Guillardia Theta Cytochrome B559 Subunit Alpha(Psbe) Protein, His-Tagged
Cat.No. : | RFL10677GF |
Product Overview : | Recombinant Full Length Guillardia theta Cytochrome b559 subunit alpha(psbE) Protein (O78466) (2-84aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Guillardia theta (Cryptomonas phi) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-84) |
Form : | Lyophilized powder |
AA Sequence : | SGGSTGERPFSDIITSIRYWIIHSITIPALFVAGWLFVSTGLAYDIFGTPRPNEYFTQER QQVPLVNDRFSAKQELEDLTKGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbE |
Synonyms | psbE; Cytochrome b559 subunit alpha; PSII reaction center subunit V |
UniProt ID | O78466 |
◆ Native Proteins | ||
a-Thrombin-97H | Native Human a-Thrombin | +Inquiry |
IL16-29736TH | Native Human IL16 | +Inquiry |
FSME-07 | Native FSME (TBE) Virus Antigen | +Inquiry |
LDLc-01H | Native Human Low-Density Lipoprotein cholesterol | +Inquiry |
Lipoxidase-37S | Active Native Soybean Lipoxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABCB9-3HCL | Recombinant Human ABCB9 cell lysate | +Inquiry |
PYGO1-1450HCL | Recombinant Human PYGO1 cell lysate | +Inquiry |
F3-2503MCL | Recombinant Mouse F3 cell lysate | +Inquiry |
CCND2-7712HCL | Recombinant Human CCND2 293 Cell Lysate | +Inquiry |
NFKBIL2-3846HCL | Recombinant Human NFKBIL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbE Products
Required fields are marked with *
My Review for All psbE Products
Required fields are marked with *
0
Inquiry Basket