Recombinant Full Length Zinc Transporter Zitb(Zitb) Protein, His-Tagged
Cat.No. : | RFL35289YF |
Product Overview : | Recombinant Full Length Zinc transporter zitB(zitB) Protein (Q8ZGY6) (1-312aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia pestis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-312) |
Form : | Lyophilized powder |
AA Sequence : | MAVSTIFSQDSNSKRLLIAFAITTLFMVTEAIGGWLSGSLALLADAGHMLTDSAALFIAL MAVHFSQRKPDPRHTFGYLRLTTLAAFVNAAALLLIVILIVWEAVHRFFSPHEVMGTPML IIAIAGLLANIFCFWILHKGEEEKNINVRAAALHVLSDLLGSVGAMIAAIVILTTGWTPI DPILSVLVSVLILRSAWRLLKESFHELLEGAPQEIDINKLRKDLCTNIYEVRNIHHVHLW QVGEQRLMTLHAQVIPPLDHDALLQRIQDYLLHHYRISHATVQMEYQHCGTPDCGINQAA PADGHHRHHHHE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zitB |
Synonyms | zitB; YPO1129; y3050; YP_1027; Zinc transporter ZitB |
UniProt ID | Q8ZGY6 |
◆ Native Proteins | ||
C8-103H | Native Human C8 Protein | +Inquiry |
S100A9-3179H | Native Human S100A9 protein(Met1-Pro114) | +Inquiry |
PLE-105P | Active Native Porcine Esterase | +Inquiry |
Hb-117M | Native Mouse Hb | +Inquiry |
Lectin-1847S | Active Native Soybean Agglutinin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRGPRX3-416HCL | Recombinant Human MRGPRX3 lysate | +Inquiry |
SSB-1466HCL | Recombinant Human SSB 293 Cell Lysate | +Inquiry |
ADRBK1-625HCL | Recombinant Human ADRBK1 cell lysate | +Inquiry |
SMR3B-910HCL | Recombinant Human SMR3B cell lysate | +Inquiry |
PDE6B-3346HCL | Recombinant Human PDE6B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All zitB Products
Required fields are marked with *
My Review for All zitB Products
Required fields are marked with *
0
Inquiry Basket