Recombinant Full Length Zinc Transporter Zitb(Zitb) Protein, His-Tagged
Cat.No. : | RFL11630EF |
Product Overview : | Recombinant Full Length Zinc transporter zitB(zitB) Protein (Q8X400) (1-311aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-311) |
Form : | Lyophilized powder |
AA Sequence : | MAHSHTSSHLPEDNNARRLLYAFGVTAGFMLVEVIGGFLSGSLALLADAGHMLTDTAALL FALLAVQFSRRPPTIRHTFGWLRLTTLAAFVNAIALVVITILIVWEAIERFRTPRPVEGG MMMAIAVAGLLANILSFWLLHHGSEEKNLNVRAAALHVLGDLLGSVGAIIAALIIIWTGW TPADPILSILVSLLVLRSAWRLLKDSVNELLEGAPVSLDIAELKRRMCREIPEVRNVHHV HVWMVGEKPVMTLHVQVIPPHDHDALLDQIQHYLMDHYQIEHATIQMEYQPCHGPDCHLN EGVSGHSHHHH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zitB |
Synonyms | zitB; Z0922; ECs0780; Zinc transporter ZitB |
UniProt ID | Q8X400 |
◆ Recombinant Proteins | ||
ATP1A2-447R | Recombinant Rhesus monkey ATP1A2 Protein, His-tagged | +Inquiry |
TRMT61A-470Z | Recombinant Zebrafish TRMT61A | +Inquiry |
TIGIT-104H | Active Recombinant Human TIGIT Protein, His-tagged | +Inquiry |
RFL1833AF | Recombinant Full Length Actinobacillus Succinogenes Probable Oxaloacetate Decarboxylase Gamma Chain(Oadg) Protein, His-Tagged | +Inquiry |
HDAC6-255HFL | Recombinant Full Length Human HDAC6 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
MARCKS-12B | Native Bovine MARCKS protein | +Inquiry |
TPO-8266H | Native Human Thyroid Peroxidase | +Inquiry |
HP-190C | Native Dog Haptoglobin | +Inquiry |
CRP-158R | Native Rabbit C-Reactive Protein | +Inquiry |
HSP90-110H | Native Human HSP90 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB1BP1-5126HCL | Recombinant Human ITGB1BP1 293 Cell Lysate | +Inquiry |
METTL4-4356HCL | Recombinant Human METTL4 293 Cell Lysate | +Inquiry |
SLAMF8-2093MCL | Recombinant Mouse SLAMF8 cell lysate | +Inquiry |
MTMR6-1150HCL | Recombinant Human MTMR6 cell lysate | +Inquiry |
GMPS-5873HCL | Recombinant Human GMPS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All zitB Products
Required fields are marked with *
My Review for All zitB Products
Required fields are marked with *
0
Inquiry Basket