Recombinant Full Length Zinc Transport Protein Zntb(Zntb) Protein, His-Tagged
Cat.No. : | RFL23901EF |
Product Overview : | Recombinant Full Length Zinc transport protein ZntB(zntB) Protein (P64425) (1-327aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-327) |
Form : | Lyophilized powder |
AA Sequence : | MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zntB |
Synonyms | zntB; Z2419; ECs1926; Zinc transport protein ZntB |
UniProt ID | P64425 |
◆ Recombinant Proteins | ||
Il13ra2-1739M | Recombinant Mouse Il13ra2 protein, His-tagged | +Inquiry |
GPBP1L1-4966C | Recombinant Chicken GPBP1L1 | +Inquiry |
DICER1-784H | Recombinant Human DICER1 protein, MYC/DDK-tagged | +Inquiry |
MTMR7-10210M | Recombinant Mouse MTMR7 Protein | +Inquiry |
RFL15972HF | Recombinant Full Length Human Ankyrin Repeat Domain-Containing Protein 46(Ankrd46) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
ALP-151P | Active Native Porcine Kidney Alkaline Phosphatase | +Inquiry |
VLDL-395H | Native Human Very Low Density Lipoprotein, DiI labeled | +Inquiry |
Rectum-024H | Human Rectum Lysate, Total Protein | +Inquiry |
Glycogen-016B | Native bovine liver Glycogen | +Inquiry |
Papain-149 | Active Native Immobilized Papain | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIPT1-4723HCL | Recombinant Human LIPT1 293 Cell Lysate | +Inquiry |
RNF135-1519HCL | Recombinant Human RNF135 cell lysate | +Inquiry |
SERPINF1-2500HCL | Recombinant Human SERPINF1 cell lysate | +Inquiry |
Ileum-473C | Cat Ileum Lysate, Total Protein | +Inquiry |
PSPC1-513HCL | Recombinant Human PSPC1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All zntB Products
Required fields are marked with *
My Review for All zntB Products
Required fields are marked with *
0
Inquiry Basket