Recombinant Full Length Zea Mays Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL4894ZF |
Product Overview : | Recombinant Full Length Zea mays Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (P48187) (15-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zea Mays |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (15-473) |
Form : | Lyophilized powder |
AA Sequence : | TLFNGTFVLAGRDQETTGFPWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAH FVPEKPMYEQGLILLPHLATLGWGVGSGGEVLDTFPYFVSGVLHLISSAVLGFGGIYHAL LGPETLEESFPFFGYVWQDRNKMTTLLGIHLILLGLGAFLLVLKALYFGGVYDTWAPGGG DVRKITNLTLSPGVIFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGSICVLGGIWHILT KPFAWARRAFVWSGEAYLSYSLGALSVFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNG LDLSRLKKDGQPWQERRSGEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLATSHFVLG FFFFVGHLWHAGRARAAAAGFEKGIDRDLEPVVYMTPLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | P48187 |
◆ Recombinant Proteins | ||
RNPS1-179H | Recombinant Human RNPS1 protein, T7-tagged | +Inquiry |
PRSS1-4737R | Recombinant Rat PRSS1 Protein | +Inquiry |
TBC1D14-4570C | Recombinant Chicken TBC1D14 | +Inquiry |
RBP3-35H | Recombinant Human RBP3 Protein, His-tagged | +Inquiry |
CCL4L1-331H | Recombinant Human Chemokine (C-C motif) Ligand 4-Like 1, His-tagged | +Inquiry |
◆ Native Proteins | ||
APOC3-669H | Native Human APOC3 protein | +Inquiry |
IgA-3882M | Native Monkey Immunoglobulin A, Tag Free | +Inquiry |
Lectin-1756C | Active Native Canavalia ensiformis Concanavalin A Protein, Agarose bound | +Inquiry |
HbA1c-19M | Native Mouse Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
Lectin-1726W | Native Wheat Germ Lectin, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPSF7-7301HCL | Recombinant Human CPSF7 293 Cell Lysate | +Inquiry |
DLX2-6907HCL | Recombinant Human DLX2 293 Cell Lysate | +Inquiry |
FCGR3-1992CCL | Recombinant Cynomolgus FCGR3 cell lysate | +Inquiry |
MAGEB3-4544HCL | Recombinant Human MAGEB3 293 Cell Lysate | +Inquiry |
UBTD1-543HCL | Recombinant Human UBTD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket