Recombinant Full Length Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL1170TF |
Product Overview : | Recombinant Full Length Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (Q1KVY2) (3-461aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Tetradesmus obliquus (Green alga) (Acutodesmus obliquus) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (3-461) |
Form : | Lyophilized powder |
AA Sequence : | TLFNGTLTVGGRDQESTGFAWWAGNARLINLSGKLLGAHVAHAGLIVYWAGAMNLFEVAH FVPEKPMYEQGLILLPHLATLGYGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGVYHSL IGPETLEESFPFFGYVWKDKNKMTNILGYHLIMLGIGAWLLVWKAMYFGGVYDTWAPGGG DVRIITNPTTNAAVVFGYLLKSPFGGDGWIVSVDNMEDIIGGHIWIGTLCILGGLWHIYT TPWPWARRAFVWSGEAYLSYSLGAISLMGFIACCMSWFNNTAYPSEFYGPTGPEASQSQA FTFLVRDQRLGANVASAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNG LDLNKLKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINAVNFVSPRSWLATSHFVLG FFFFVGHLWHAGRARAAAAGFEKGIDRLDEPVLSMRPLD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | Q1KVY2 |
◆ Recombinant Proteins | ||
HHIP-2076R | Recombinant Rhesus monkey HHIP Protein, His-tagged | +Inquiry |
RASSF3-7447M | Recombinant Mouse RASSF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MS4A1-22H | Recombinant Human MS4A1 Protein (T2-P297 end), N-8×His-Flag-TEV-tagged | +Inquiry |
SYNJ2-5869R | Recombinant Rat SYNJ2 Protein | +Inquiry |
SGR-RS09140-646S | Recombinant Streptomyces griseus subsp. griseus NBRC 13350 SGR_RS09140 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-354G | Native Guinea Pig IgG | +Inquiry |
Streptavidin-24 | Streptavidin | +Inquiry |
IgG1-227H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
TF-31158TH | Native Human TF | +Inquiry |
Collagen Type I-05H | Native Human Collagen Type I | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOB1-3776HCL | Recombinant Human NOB1 293 Cell Lysate | +Inquiry |
MRPL15-4194HCL | Recombinant Human MRPL15 293 Cell Lysate | +Inquiry |
TOMM34-870HCL | Recombinant Human TOMM34 293 Cell Lysate | +Inquiry |
Colon-855R | Mini Rabbit Colon Membrane Lysate, Total Protein | +Inquiry |
METTL2B-1081HCL | Recombinant Human METTL2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket