Recombinant Full Length Zea Mays Derlin-1.2(Der1.2) Protein, His-Tagged
Cat.No. : | RFL35339ZF |
Product Overview : | Recombinant Full Length Zea mays Derlin-1.2(DER1.2) Protein (Q4G2J5) (1-243aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zea Mays |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-243) |
Form : | Lyophilized powder |
AA Sequence : | MSSPAEYYKSLPPISKAYGTLCFFTTVLVRLHILNPLFLYLYYPRVFKKFEVWRIFTSFF FLGPFSINFGIRLLMIARYGVMLEKGAFDKRTADFLWMMIFGAISLLVLSVIPQLNTYVL GLPMVSMLVYVWSRENPNAQINIYGILQLKAFYLPWVMLLLDVIFGSPLMPGLLGIMVGH LYYYFAVLHPLATGKNYLKTPKWVHKIVARFRIGMQANAPVRAPANGNAGTGAFRGRSYR LNQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DER1.2 |
Synonyms | DER1.2; SOR; Derlin-1.2; ZmDerlin1-2 |
UniProt ID | Q4G2J5 |
◆ Native Proteins | ||
PLE-105P | Active Native Porcine Esterase | +Inquiry |
Thromboplastin-078R | Native Rabbit Thromboplastin Protein | +Inquiry |
LDH5-8342H | Native Human LDH5 | +Inquiry |
APOB-1H | Native Human Apolipoprotein B | +Inquiry |
ALP-8330C | Native Calf ALP | +Inquiry |
◆ Cell & Tissue Lysates | ||
Thymus-549E | Equine Thymus Lysate, Total Protein | +Inquiry |
NAT1-1168HCL | Recombinant Human NAT1 cell lysate | +Inquiry |
TMEM261-137HCL | Recombinant Human TMEM261 lysate | +Inquiry |
HA-3013HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
MZB1-4338HCL | Recombinant Human MGC29506 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DER1.2 Products
Required fields are marked with *
My Review for All DER1.2 Products
Required fields are marked with *
0
Inquiry Basket