Recombinant Full Length Zea Mays Cytochrome P450 71C4(Cyp71C4) Protein, His-Tagged
Cat.No. : | RFL34884ZF |
Product Overview : | Recombinant Full Length Zea mays Cytochrome P450 71C4(CYP71C4) Protein (Q43257) (1-538aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zea Mays |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-538) |
Form : | Lyophilized powder |
AA Sequence : | MAAQLHHALYELLHEAAAAQRALLLAIPFSLLLLPLLLRYLAASASASATKNDGAAPASD PDKLLSLLPSPPMKLPIIGHLHLMGDIPYVSLAALATRYGPDLMLLRLGAVPTVVVSSPR VAEAVLRTYDHVFSSRPRSLVSDIIMYGATDSCFAPYGDHFRKARKLVTVHLLNASKVRS QRPAREEEVRGALDRVRRAAAAREPVDMSELLHSFVNNLVCRAVSGKFSMEEGRNRLFRE LTDINAGLLGGFHIQDYFPRLGRIELVRKVACAKTRRVRKRWDDLLDKLIDDHAARMATH QDEDDDKDFIYVLLSLQKEYGLTRDHIKAILIDMFEAGTDTSYMTLEFAMTELIRKPHLM KKLQEEVRRNVPAGQEMVTEDNLPGMTDLKAVIKETLRLHPPVPLLLPHYSLDACEVAGY TIPANTRVVVNAWALGRHSGYWERENEFVPERFLSGDVAGGVDLKPNEFQFLAFGSGRRM CPGVHSASATIEAMLSNLMYRFDWQLPAGMKAEDVDMTEVFGITVSRKEKLLLVPQAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYP71C4 |
Synonyms | CYP71C4; BX2; indole-2-monooxygenase; Cytochrome P450 71C4; Protein benzoxazineless 2 |
UniProt ID | Q43257 |
◆ Recombinant Proteins | ||
VDAC3-4286H | Recombinant Human VDAC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Hspa1l-1453R | Recombinant Rat Hspa1l protein, His-tagged | +Inquiry |
VPS26A-18366M | Recombinant Mouse VPS26A Protein | +Inquiry |
RFL27255SF | Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Mitochondrial Carrier C8C9.12C (Spac8C9.12C) Protein, His-Tagged | +Inquiry |
gE-446V | Recombinant Tick-born Encephalitis Virus gE Protein | +Inquiry |
◆ Native Proteins | ||
Amylase-64H | Active Native Human Amylase, alpha | +Inquiry |
Lectin-1727W | Native Wheat Germ Lectin, Biotin conjugated | +Inquiry |
Collagen Type I-05H | Native Human Collagen Type I | +Inquiry |
FBa-12H | Native Human Factor Ba protein | +Inquiry |
CALMODULIN-185B | Active Native Bovine Calmodulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
C8orf42-7950HCL | Recombinant Human C8orf42 293 Cell Lysate | +Inquiry |
KCNJ1-5049HCL | Recombinant Human KCNJ1 293 Cell Lysate | +Inquiry |
MXD4-1157HCL | Recombinant Human MXD4 cell lysate | +Inquiry |
IL36A-5238HCL | Recombinant Human IL1F6 293 Cell Lysate | +Inquiry |
IL17B-5244HCL | Recombinant Human IL17B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CYP71C4 Products
Required fields are marked with *
My Review for All CYP71C4 Products
Required fields are marked with *
0
Inquiry Basket