Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Mitochondrial Carrier C8C9.12C (Spac8C9.12C) Protein, His-Tagged
Cat.No. : | RFL27255SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized mitochondrial carrier C8C9.12c (SPAC8C9.12c) Protein (O14281) (1-303aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-303) |
Form : | Lyophilized powder |
AA Sequence : | MTYAAEDFDYEGLPIGSPMYAHLLAGAFSGILEHSVMYPVDAIKTRMQMLNGVSRSVSGN IVNSVIKISSTEGVYSLWRGISSVIMGAGPSHAIYFSVLEFFKSKINASPDRPLASALAG ACAITISDAFMTPFDVIKQRMQLPSRKYKSALHCATTVFRNEGLGAFYISYPTCIAMSIP FTAIQVATYDTCMSFLNPNAVYDPTSHIISGGLSGAIASSLTTPLDVVKTLLQTRGSSSI PEVRKCKGSLDVVRFIYNYGGIPSFFKGIRPRMVVAMPATAVSWAAYEAGKEILIRVSKT SQA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPAC8C9.12c |
Synonyms | SPAC8C9.12c; Uncharacterized mitochondrial carrier C8C9.12c |
UniProt ID | O14281 |
◆ Native Proteins | ||
Prothrombin-59H | Native Human Prothrombin Frag 1 | +Inquiry |
Plasmin-250H | Active Native Human Plasmin | +Inquiry |
Lectin-1770D | Active Native Dolichos Biflorus Lectin Protein, Fluorescein labeled | +Inquiry |
Lectin-1826P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein | +Inquiry |
FGA-5H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
WFDC2-2056HCL | Recombinant Human WFDC2 cell lysate | +Inquiry |
OTULIN-252HCL | Recombinant Human OTULIN lysate | +Inquiry |
RRP7A-2141HCL | Recombinant Human RRP7A 293 Cell Lysate | +Inquiry |
FFAR2-6256HCL | Recombinant Human FFAR2 293 Cell Lysate | +Inquiry |
CCDC121-152HCL | Recombinant Human CCDC121 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPAC8C9.12c Products
Required fields are marked with *
My Review for All SPAC8C9.12c Products
Required fields are marked with *
0
Inquiry Basket