Recombinant Full Length Zea Mays Aquaporin Sip1-1(Sip1-1) Protein, His-Tagged
Cat.No. : | RFL11752ZF |
Product Overview : | Recombinant Full Length Zea mays Aquaporin SIP1-1(SIP1-1) Protein (Q9ATM3) (1-245aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zea Mays |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-245) |
Form : | Lyophilized powder |
AA Sequence : | MAMGATVRAAAADAVVTFLWVLCASALGASTAAVTSYLGVQEGAGHYALLVTTSLLSVLLFTFDLLCGALGGASFNPTDFAASYAAGLDSPSLFSVALRFPAQAAGAVGGALAISELMPAQYKHTLAGPSLKVDPHTGALAEGVLTFVITLTVLWVIVKGPRNVILKTLLLSTSIVSVILAGAEYTGPSMNPANAFGWAYVNNWHNTWEQLYVYWICPFIGAMLAGWIFRVVFLPPAPKPKTKKA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SIP1-1 |
Synonyms | SIP1-1; SIP1A; Aquaporin SIP1-1; Small basic intrinsic protein 1-1; ZmSIP1-1; ZmSIP1;1 |
UniProt ID | Q9ATM3 |
◆ Recombinant Proteins | ||
WNT3-5163M | Recombinant Mouse WNT3 Protein, His-SUMO-tagged | +Inquiry |
DOK5-3943HF | Recombinant Full Length Human DOK5 Protein, GST-tagged | +Inquiry |
RFL20415IF | Recombinant Full Length Idiomarina Loihiensis Upf0060 Membrane Protein Il1642(Il1642) Protein, His-Tagged | +Inquiry |
SAOUHSC-01351-1330S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_01351 protein, His-tagged | +Inquiry |
IL2RA-5199H | Recombinant Human IL2RA Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1811N | Active Native Narcissus Pseudonarcissus Lectin Protein, Biotinylated | +Inquiry |
IgG-340G | Native Goat IgG | +Inquiry |
ApoB-3556H | Native Human ApoB | +Inquiry |
HP-190C | Native Dog Haptoglobin | +Inquiry |
HSV-2ag-268V | Active Native HSV-2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF544-2047HCL | Recombinant Human ZNF544 cell lysate | +Inquiry |
FAM122C-6441HCL | Recombinant Human FAM122C 293 Cell Lysate | +Inquiry |
PARD3-1283HCL | Recombinant Human PARD3 cell lysate | +Inquiry |
SPRR1B-629HCL | Recombinant Human SPRR1B lysate | +Inquiry |
MARVELD3-1063HCL | Recombinant Human MARVELD3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SIP1-1 Products
Required fields are marked with *
My Review for All SIP1-1 Products
Required fields are marked with *
0
Inquiry Basket