Recombinant Full Length Zaglossus Bruijni Nadh-Ubiquinone Oxidoreductase Chain 1(Mt-Nd1) Protein, His-Tagged
Cat.No. : | RFL4839ZF |
Product Overview : | Recombinant Full Length Zaglossus bruijni NADH-ubiquinone oxidoreductase chain 1(MT-ND1) Protein (O78713) (1-303aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zaglossus bruijni (Western long-beaked echidna) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-303) |
Form : | Lyophilized powder |
AA Sequence : | ILLAVAFLTLIERKILGYMQFRKGPNIVGPHGLLQPIADAVKLFIKEPLRPMTSSIYMFI LAPILALSLALTIWVPLPMPLPLIDLNLGLLFVLSVSGLSVYSILWSGWASNSKYALTGA LRAVAQTISYEVTLAIILLSIMLINGSFTLTTLNLTQEFMWLVVPTWPLMLTRFISTLAE TNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIIIMNALTVILFFGAYHLIFLP ELSTINFMIKTMMLTSLFLWIRASYPRFRYDQLMHLLWKNFLPITLVTCLWFIMLPLALS WIP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MT-ND1 |
Synonyms | MT-ND1; MTND1; NADH1; ND1; NADH-ubiquinone oxidoreductase chain 1; NADH dehydrogenase subunit 1; Fragment |
UniProt ID | O78713 |
◆ Recombinant Proteins | ||
SELPLG-420H | Recombinant Human SELPLG, His tagged | +Inquiry |
RFL5230AF | Recombinant Full Length Arabidopsis Thaliana Ring-H2 Finger Protein Atl7(Atl7) Protein, His-Tagged | +Inquiry |
DOK5-2813H | Recombinant Human DOK5 Protein, GST-tagged | +Inquiry |
N-388S | Recombinant SARS N, His-tagged | +Inquiry |
RPL-262P | Recombinant Peptostreptococcus RPL, His-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
Acid phosphatase-158 | Active Native Wheat Germ Acid phosphatase Protein | +Inquiry |
Proteoglycans-52H | Native Human Proteoglycans | +Inquiry |
MB-8227H | Native Human Heart Myoglobin | +Inquiry |
FGG -60R | Native Rabbit Fibrinogen | +Inquiry |
CPB2-27270TH | Native Human CPB2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSAD-7252HCL | Recombinant Human CSAD 293 Cell Lysate | +Inquiry |
FANCE-594HCL | Recombinant Human FANCE cell lysate | +Inquiry |
KRTAP2-4-4846HCL | Recombinant Human KRTAP2 293 Cell Lysate | +Inquiry |
GALNT9-6033HCL | Recombinant Human GALNT9 293 Cell Lysate | +Inquiry |
HSD3B7-5368HCL | Recombinant Human HSD3B7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MT-ND1 Products
Required fields are marked with *
My Review for All MT-ND1 Products
Required fields are marked with *
0
Inquiry Basket