Recombinant Full Length Yersinia Pseudotuberculosis Serotype Ib Upf0283 Membrane Protein Ypts_2342 (Ypts_2342) Protein, His-Tagged
Cat.No. : | RFL24410YF |
Product Overview : | Recombinant Full Length Yersinia pseudotuberculosis serotype IB UPF0283 membrane protein YPTS_2342 (YPTS_2342) Protein (B2K5F2) (1-353aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia pseudotuberculosis serotype IB |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-353) |
Form : | Lyophilized powder |
AA Sequence : | MSEPLKPRIDFEQPLQSLDEPVLKSAQAFDEQAAEKFYPAAPELDAEDEEGRVEGLVNAA LKPKRSLWRKMVTAGMVILGASVIAQSVQWVNQAWQQQDWIALGATTAGGLIILAGVGSV VTEWRRLYHLRQRAEERDIARALLVSHGVGQGRVFCEKLARQAGLDQGHPALQRWLASLH ETHNDREVVELYAKLVQPALDNQARAEISRYAAESALMIAVSPLALVDMAFIAWRNIRLI NRIAALYGIELGYFSRIRLFRLVLLNIAFAGASELVREVGMDWLSQDLAARLSARAAQGI GAGLLTARLGIKAMELCRPLPWLEGDKPKLGDFRRQLMNQLKNTLPKKDKTAH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | YPTS_2342 |
Synonyms | YPTS_2342; UPF0283 membrane protein YPTS_2342 |
UniProt ID | B2K5F2 |
◆ Native Proteins | ||
ALPL-66C | Active Native Calf Alkaline Phosphatase | +Inquiry |
Thromboplastin-078R | Native Rabbit Thromboplastin Protein | +Inquiry |
Collagen-316B | Native Bovine Collagen Type II | +Inquiry |
HP-4387H | Native Human Haptoglobin | +Inquiry |
PLAU-31687TH | Native Human PLAU | +Inquiry |
◆ Cell & Tissue Lysates | ||
LY6K-4597HCL | Recombinant Human LY6K 293 Cell Lysate | +Inquiry |
INSR-2648HCL | Recombinant Human INSR cell lysate | +Inquiry |
RNF217-548HCL | Recombinant Human RNF217 lysate | +Inquiry |
EIF4A2-6653HCL | Recombinant Human EIF4A2 293 Cell Lysate | +Inquiry |
APLNR-8791HCL | Recombinant Human APLNR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All YPTS_2342 Products
Required fields are marked with *
My Review for All YPTS_2342 Products
Required fields are marked with *
0
Inquiry Basket