Recombinant Full Length Yersinia Pestis Spermidine Export Protein Mdti(Mdti) Protein, His-Tagged
Cat.No. : | RFL21198YF |
Product Overview : | Recombinant Full Length Yersinia pestis Spermidine export protein MdtI(mdtI) Protein (A4TJI9) (1-109aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia Pestis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-109) |
Form : | Lyophilized powder |
AA Sequence : | MQQLEFYPIAFLILAVMLEIVANILLKMSDGFRRKWLGILSLLSVLGAFSALAQAVKGIE LSVAYALWGGFGIAATVAAGWILFNQRLNYKGWIGLILLLAGMVMIKLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mdtI |
Synonyms | mdtI; YPDSF_1053; Spermidine export protein MdtI |
UniProt ID | A4TJI9 |
◆ Recombinant Proteins | ||
RFL28147HF | Recombinant Full Length Haemophilus Influenzae Probable Intracellular Septation Protein A (Hi_0826) Protein, His-Tagged | +Inquiry |
SOX7-2722H | Recombinant Human SOX7 Protein, His-tagged | +Inquiry |
KPNA1-5792HF | Recombinant Full Length Human KPNA1 Protein, GST-tagged | +Inquiry |
NITR13-6774Z | Recombinant Zebrafish NITR13 | +Inquiry |
UBXN10-6478H | Recombinant Human UBXN10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Mb-8232R | Native Rat Myoglobin | +Inquiry |
Hld-730S | Active Native S. aureus delta Hemolysin Protein | +Inquiry |
AZU1-40H | Native Human Azurocidin | +Inquiry |
PROC-64H | Active Native Human Activated Protein C | +Inquiry |
FTL-673H | Native Human Ferritin, Light Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
RALYL-2538HCL | Recombinant Human RALYL 293 Cell Lysate | +Inquiry |
Brain-535E | Equine Brain whole Lysate, Total Protein | +Inquiry |
LMX1B-383HCL | Recombinant Human LMX1B lysate | +Inquiry |
Kidney-27H | Human Kidney Tumor Tissue Lysate | +Inquiry |
HPX-2789HCL | Recombinant Human HPX cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mdtI Products
Required fields are marked with *
My Review for All mdtI Products
Required fields are marked with *
0
Inquiry Basket