Recombinant Full Length Yersinia Pestis Bv. Antiqua Macrolide Export Atp-Binding/Permease Protein Macb 2(Macb2) Protein, His-Tagged
Cat.No. : | RFL6056YF |
Product Overview : | Recombinant Full Length Yersinia pestis bv. Antiqua Macrolide export ATP-binding/permease protein MacB 2(macB2) Protein (Q1C5W7) (1-678aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia pestis bv. Antiqua |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-678) |
Form : | Lyophilized powder |
AA Sequence : | MTGPQQGKILLRLENVSREFITGEQTVRVLNNINLTLHSGEMVAIVGTSGSGKSTLMNIL GCLDKPSAGEYWVAGRIPQYLGSDALAELRREHFGFIFQRYHLLNDLSARENVEIPAIYA GIDREERRKRAVNLLSRIGLAERLDYRPSQLSGGQQQRVSIARALMNGGDVILADEPTGA LDTHSGNEVLNILKDLHQQGHTVVIVTHDMSIAEHAQRIIELKDGEIIADRPRDHAQEKP KMVDIPSVIDIPSMDEKISTGAQQETEIARKPLLTRWKVQYDRLHEAFKMAILAMAAQRL RTALTMLGIIIGIASVVSVVALGKGSQQQVLANINAMGTSTLEIFPGKDFGDMRSAAIHT LRDTDADVLAQQGYIHSVTPTVSTSVTLRYGNKSVSGTVNGVGEQYFLVRGYTIAQGMAF TRTSVNDLMQDAVIDENTRDKLFPNGETPLGKVILLGSLPCRVIGVAAKKQSGFGSDENL NVWIPYTTAMKRMLGQSYLKSITVRVNDDIDLANAEQGVIKLLSQRHGTQDFFVMNTDSI RQTIQATTSTMTLLVSMIAVISLIVGGIGVMNIMLVSVTERTKEIGVRMAVGARASDIMQ QFLIEAVLVCLLGGSLGVALSLGIGLLFSLFSSNFSMVYSAASIITAFVCSSLIGVIFGF FPAKRAAEMDPIRALERE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB2 |
Synonyms | macB2; YPA_2190; Macrolide export ATP-binding/permease protein MacB 2 |
UniProt ID | Q1C5W7 |
◆ Recombinant Proteins | ||
Protein L-3141P | Active Recombinant Peptostreptococcus magnus Protein L protein, His-tagged | +Inquiry |
Eif2s2-2776M | Recombinant Mouse Eif2s2 Protein, Myc/DDK-tagged | +Inquiry |
OS9-4204R | Recombinant Rat OS9 Protein | +Inquiry |
IGFBP1-2490H | Recombinant Human IGFBP1 Protein (Met1-Asn259), N-His tagged | +Inquiry |
RFL12033BF | Recombinant Full Length Burkholderia Pseudomallei Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
S100A7-3195H | Native Human S100A7 protein(Met1-Gln101) | +Inquiry |
C3c-11H | Native Human C3c Protein | +Inquiry |
Proteoglycans-50B | Native Bovine Proteoglycans | +Inquiry |
Papain-149 | Active Native Immobilized Papain | +Inquiry |
F10-302R | Native Rat Factor X | +Inquiry |
◆ Cell & Tissue Lysates | ||
MFAP4-4349HCL | Recombinant Human MFAP4 293 Cell Lysate | +Inquiry |
Spleen-745R | Rabbit Spleen Lysate, Total Protein | +Inquiry |
EYA1-6492HCL | Recombinant Human EYA1 293 Cell Lysate | +Inquiry |
ZFP42-1977HCL | Recombinant Human ZFP42 cell lysate | +Inquiry |
IL17RA-1252CCL | Recombinant Cynomolgus IL17RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB2 Products
Required fields are marked with *
My Review for All macB2 Products
Required fields are marked with *
0
Inquiry Basket