Recombinant Full Length Yersinia Enterocolitica Serotype O:8 / Biotype 1B Cdp-Diacylglycerol--Glycerol-3-Phosphate 3-Phosphatidyltransferase(Pgsa) Protein, His-Tagged
Cat.No. : | RFL2439YF |
Product Overview : | Recombinant Full Length Yersinia enterocolitica serotype O:8 / biotype 1B CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase(pgsA) Protein (A1JLU9) (1-182aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia enterocolitica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-182) |
Form : | Lyophilized powder |
AA Sequence : | MQLNIPTWLTLFRVVLIPFFVLAFYLPFVWAPMVCAIIFVFAAATDWFDGFLARRWKQTT RFGAFLDPVADKVMVAIALVLVAEHYHVWWITLPAATMIAREIIISSLREWMAEIGKRSS VAVSWIGKVKTTAQMGSLVGLLWRPDHNIELASFVLLYIAAVLTFWSMFQYLNAAWKDLL EP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pgsA |
Synonyms | pgsA; YE1829; CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase; Phosphatidylglycerophosphate synthase; PGP synthase |
UniProt ID | A1JLU9 |
◆ Native Proteins | ||
ORM1-8017R | Native Rat Serum Alpha-1-Acid GlycoProtein | +Inquiry |
F2-647P | Native Pig F2 | +Inquiry |
Lectin-1750M | Active Native Maackia Amurensis Lectin II Protein | +Inquiry |
GPCP-28 | Active Native Glycerophosphocholine phosphodiesterase | +Inquiry |
FG-163B | Native Bovine fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACBD5-9105HCL | Recombinant Human ACBD5 293 Cell Lysate | +Inquiry |
LUC7L2-4606HCL | Recombinant Human LUC7L2 293 Cell Lysate | +Inquiry |
S100A12-2094HCL | Recombinant Human S100A12 293 Cell Lysate | +Inquiry |
QRICH1-2636HCL | Recombinant Human QRICH1 293 Cell Lysate | +Inquiry |
PLOD3-1379HCL | Recombinant Human PLOD3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pgsA Products
Required fields are marked with *
My Review for All pgsA Products
Required fields are marked with *
0
Inquiry Basket