Recombinant Full Length Escherichia Coli Cdp-Diacylglycerol--Glycerol-3-Phosphate 3-Phosphatidyltransferase(Pgsa) Protein, His-Tagged
Cat.No. : | RFL24756EF |
Product Overview : | Recombinant Full Length Escherichia coli CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase(pgsA) Protein (Q1RAM8) (1-182aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-182) |
Form : | Lyophilized powder |
AA Sequence : | MQFNIPTLLTLFRVILIPFFVLVFYLPVTWSPFAAALIFCVAAVTDWFDGFLARRWNQST RFGAFLDPVADKVLVAIAMVLVTEHYHSWWVTLPAATMIAREIIISALREWMAELGKRSS VAVSWIGKVKTTAQMVALAWLLWRPNIWVEYAGIALFFVAAVLTLWSMLQYLSAARADLL DQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pgsA |
Synonyms | pgsA; UTI89_C2113; CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase; Phosphatidylglycerophosphate synthase; PGP synthase |
UniProt ID | Q1RAM8 |
◆ Recombinant Proteins | ||
YWHABB-12361Z | Recombinant Zebrafish YWHABB | +Inquiry |
Chrna1-5380M | Recombinant Mouse Chrna1 protein, His-tagged | +Inquiry |
ACPP-146H | Recombinant Human ACPP Protein, His-tagged | +Inquiry |
Gbp5-1259R | Recombinant Rat Gbp5 protein, His & T7-tagged | +Inquiry |
PLPP3-590H | Recombinant Human PLPP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Lectin-1814P | Active Native Peanut Lectin Protein, Cy3 labeled | +Inquiry |
Lecithin-08E | Native Egg Yolk Lecithin | +Inquiry |
CASQ2-30C | Native Canine CASQ2 | +Inquiry |
GG-182B | Native Bovine Gamma Globulin | +Inquiry |
LDL-396H | Native Human Low Density Lipoprotein, DiI labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPL32-2205HCL | Recombinant Human RPL32 293 Cell Lysate | +Inquiry |
PPP1CA-2952HCL | Recombinant Human PPP1CA 293 Cell Lysate | +Inquiry |
PDZRN3-1329HCL | Recombinant Human PDZRN3 cell lysate | +Inquiry |
TNFRSF1A-1693MCL | Recombinant Mouse TNFRSF1A cell lysate | +Inquiry |
ISCA2-5154HCL | Recombinant Human ISCA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All pgsA Products
Required fields are marked with *
My Review for All pgsA Products
Required fields are marked with *
0
Inquiry Basket