Recombinant Full Length Yersinia Enterocolitica Serotype O:8 / Biotype 1B Arginine Exporter Protein Argo(Argo) Protein, His-Tagged
Cat.No. : | RFL11243YF |
Product Overview : | Recombinant Full Length Yersinia enterocolitica serotype O:8 / biotype 1B Arginine exporter protein ArgO(argO) Protein (A1JPP8) (1-205aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia enterocolitica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-205) |
Form : | Lyophilized powder |
AA Sequence : | MLAVFLQGFALSAAMILPLGPQNAFVMNQGIKRQHHLMSASLCALSDIILICAGIFGGSA LLNRSPLLLALVTWGGVAFLLWYGWGALMAAWRGDSSSAAVAAGTQGRWRIIVTLLAVTW LNPHVYLDTFVVLGSLGGQLLPDVRPWFAFGAVSASVAWFFALALLAAWLSPWLNRPGSQ RVINLLVGGVMWFIAFQLARQGLNL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | argO |
Synonyms | argO; YE3405; Arginine exporter protein ArgO |
UniProt ID | A1JPP8 |
◆ Recombinant Proteins | ||
CRYZ-257H | Recombinant Human CRYZ, His-tagged | +Inquiry |
BKDB-1138B | Recombinant Bacillus subtilis BKDB protein, His-tagged | +Inquiry |
ANTXRL-1709M | Recombinant Mouse ANTXRL Protein | +Inquiry |
RFL2815PF | Recombinant Full Length Pan Troglodytes Taste Receptor Type 2 Member 3(Tas2R3) Protein, His-Tagged | +Inquiry |
POU6F1-3025H | Recombinant Human POU6F1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IGHA2 -19H | Native Human IgA2 | +Inquiry |
ALB-311H | Native Human Albumin, Texas Red Label | +Inquiry |
Lectin-1780G | Active Native Griffonia Simplicifolia Lectin I Protein, Fluorescein labeled | +Inquiry |
GFAP-526H | Native Human GFAP protein | +Inquiry |
ALB-20H | Native Human Serum Albumin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADRA2A-9000HCL | Recombinant Human ADRA2A 293 Cell Lysate | +Inquiry |
SHE-1858HCL | Recombinant Human SHE 293 Cell Lysate | +Inquiry |
COPG-7360HCL | Recombinant Human COPG 293 Cell Lysate | +Inquiry |
BRD7-8411HCL | Recombinant Human BRD7 293 Cell Lysate | +Inquiry |
LRRC48-4627HCL | Recombinant Human LRRC48 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All argO Products
Required fields are marked with *
My Review for All argO Products
Required fields are marked with *
0
Inquiry Basket