Recombinant Full Length Yarrowia Lipolytica Ph-Response Regulator Protein Palh/Rim21(Rim21) Protein, His-Tagged
Cat.No. : | RFL34998YF |
Product Overview : | Recombinant Full Length Yarrowia lipolytica pH-response regulator protein palH/RIM21(RIM21) Protein (Q9UVF6) (1-632aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yarrowia lipolytica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-632) |
Form : | Lyophilized powder |
AA Sequence : | MHSDAPTPVANELSEVSHLAEGDNASFSAGNFTVLQLPSDPSHCIDYAIPAGTLVIVDPN NPDNNRTVKLQAPAVFRPQCALGGTRAPAPRPEESFPDWSEYQKYHHNDRRDPFYGSVTP IAYTIAASTVTAWMLLIILFLSRKPSPLFQKIAVLITAVSLTVFLAQATDTLESQYNEGY QNAYELRHKIMGGWAFRILQVITCVITWLARLQVVIRLFDVPKINTRLAVVGSTLIFTNA TIWACLNLIPPWSQYVRNAKSVLPVFGALCSLLLEVFYLVVVVIYSISKRKYAYSRTSIV MAAISWLAMILPMVFIVFDIAHYWIAGWSDFIRWTADAAASVVVWEWTNVIVYQERREQR QSVLGRQVYRDEILDFKGDNGGGTVGGGRTKYPSRMEEDDVPFRSSPNDHHFTSNIPTSA GEGQSFQFFKRARLPMYSRKIWKIARGESAASNNTHYEHAIIEEEEEESIERNRRTPTVQ ENGEEDDEETYDEENDQYSQDNHSSVHSFESSRPSQHPVPSSGGTRAVGHTHFPLPGQSE GAHTTSPAAAAAAAEPEPEPVAGPSGGAAAHGDSDDDSDNSDDSSLASFTVIQQTGFSVD NQGVPEYDADSAPPTFEPIPGFHRQDYSDAKG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RIM21 |
Synonyms | RIM21; PAL2; YALI0F12397g; pH-response regulator protein palH/RIM21 |
UniProt ID | Q9UVF6 |
◆ Recombinant Proteins | ||
KDM6BB-3285Z | Recombinant Zebrafish KDM6BB | +Inquiry |
GCH1-2197H | Recombinant Human GCH1 Protein, His-tagged | +Inquiry |
FAM110B-3078Z | Recombinant Zebrafish FAM110B | +Inquiry |
CTBP1-5588H | Recombinant Human CTBP1 protein, His-tagged | +Inquiry |
SERPINE2-1219HFL | Recombinant Full Length Human SERPINE2 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-224M | Native Mouse Immunoglobulin G | +Inquiry |
DI-24 | Active Native Diaphorase (NADH) | +Inquiry |
LDHA-26867TH | Native Human LDHA | +Inquiry |
ALB-320H | Native Human Albumin Rhodamine | +Inquiry |
CAPN1-27397TH | Active Native Human Calpain-1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
A-20-155H | A-20 Whole Cell Lysate | +Inquiry |
PDP1-3324HCL | Recombinant Human PDP1 293 Cell Lysate | +Inquiry |
PDIA5-1323HCL | Recombinant Human PDIA5 cell lysate | +Inquiry |
MPST-4223HCL | Recombinant Human MPST 293 Cell Lysate | +Inquiry |
RBMS1-2462HCL | Recombinant Human RBMS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RIM21 Products
Required fields are marked with *
My Review for All RIM21 Products
Required fields are marked with *
0
Inquiry Basket